Completed jobs



Tag
yecB
MS11_yecB
TdfF
TdfF1
summa_check
rhNKG2F_CM_mammalian
rhNKG2F_GNN_mammalian
hsNKG2F
rhNKG2F_RF
rhNKG2F_RF_mammalian
hsNKG2F_CM
hsNKG2F_GNN
ulLaLr0B
lX2UMb0O
Module_51_Part_D
hFAM227A
hFAM205C
hNHE11
hsAC
Peptidase_GNN
Peptidase
Peptidase_again
Peptidase_Consensus_method
Peptidase_(391-522)
Peptidase_with_consensus
Peptidase_with_GNN
qqq
shalu
bqAyk0eH
MBB_190_M_-_Group_3_ProteinPrompt_Table
MBB_190_M_Group_3_ProteinPrompt_Table
MBB190M3ProteinPromptTable
pleasework
UP1_consensus
UP1_neural
UP1_test
UP1_forest
SOD
SOD1
Lm_s-DAPK-1
redox1
Munc18c
hSTX4
andrea88
Example1
QKRISEICME
R1TGfSpX
R7RUyoJB
eE5zM84Q
RhOb4TgE
AamR
aap
XDIdyGuw
MiaB
Elp3
LipA
MtaB
RSAD1-2
MoaA
TYW1
Elp2
RSAD1
Elp3-1
MAAGSVESQRSQAASERPVAGQAG
PAF49_search
QRILAAETDRLSYVGNNFGTGALKCNTL
GDS0BXPo
EPDDRQKAVLVQFSNGKLQNPGDMRFTLYNSTDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCRHFVGILNKTSGQMEVYDAELFNMQPLFAGMGTEVIKLGGQHLYLLAFCQ
PHRRHIALSPRYLSRKRTGIREQLDAELL
CGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQR
240429_AHNAK_JYK
PPARgamma
Generate_random_string
MBB_190_M5.1_Machine_Learning
5.1_machine_learning
gffhfjojfdkdfjdkfdkfhkedjlkslskjd
hellocrushwagkanalangumalispls
cMbw8S0D
1233
870
1272
82,652~83038_387bp
654
wHHJwBf0
387-1
1701
112233
lKOe5vSH
12345
67890
Poorly_Characterized_Protein
uNNzMMdm
tag
Mgr2_interactions
mgr2
protein_-protein_interaction
vets
collagen
PXN
Paxillin
PARP1_zz
WwfzxWua
pcsk1
lemd2
03qeS0rD
hdock-hu
cap
IE1_histone
QRich
190.1_M5.1
anonymous
msmeg1428
Sestrin2
TRsrRVWC
Mitofusion-2
TvL1gT0k
FMS15
MoHT3s8R
module5.1D
PPP1CB
Inrection_with_STAT5B
oleid
spike_ppi_2
spike_ppi
spikee
spike
spike3
Module_5.1_Machine_Learning_Prediction_of_PPIs
TREM2
DAP12
ADARB1
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
test2
Input_any_preferred_job_name
cutiepie
wb_binders
aurkb_binders
oVInA1E1
IEyg78Ti
S2bIXNCW
Livin_B
RSK-SK2
ASPH
HtTIiEbi
azktzJxZ
hELTEKeX
a3consensus
a7
a3GNN
w1
beta4
a7consensus
b4consensus
b4GNN
TbRRM1_Tb927.2.4710
TcUBP1_full_lenght_226_aa
Model1-6
Model1
Models5
Models3
Models4
Model8
Models2
Model6
Model1-2
Model1-4
Model4
Model9
Model3
Model7
Model5
Model1-3
Model2
Models1
yusuke
COL5a3_human
7JJn4c1X
nils
PRDX1-test
464
320
GW1knRAq
kbEvnhtt
6cweiqcB
6nRaNJp3
BcpOHilD
LwaPRD1K
calmodulin
BSM-MT
NbSCP2
190M5Poorly_Characterized_Protein
44146-44619
Ape1_Ref-1
1-nc
XpnvOIfp
PXR-interactors_ProteinPrompt_Consensus
MBB_190_M5.1_Machine_Learning
Prova3_PP
6BVtTSAw
PPi_try14
polr3gl
>NP_006263.1_protein_S100-B_[Homo_sapiens]
NBSCP2
Pekwno01
waho24
NCBZ1
zTdXBTLp
pl4
HIDE1_full
Cd163
naa10
lBVbLUw5
567
Lab_assistants
C13A4-interactors_ProteinPrompt_GraphN
SMC
PDE4B2
kif1c_1
mtTeXybf
CBVQ9g8w
PPI_Test
TNKS1_Random_Forest
K39
ZPBP2
4ZZ7MwVX
NAT9_!
Jag
Cited1
dpyVnAh3
CE9eKpOa
polr3e
TTRmice
Helguero_1
MAVS
ZrpgDvrv
M5_Machine_Learning
fL0C0Z58
>NP_004172.2_ubiquitin_carboxyl-terminal_hydrolase_isozyme_L1_[Homo_sapiens]
HILPDA_protein_interactions
C13_random
SsJb3yq3
ncam1
zDZi5WRF
9QzyPAd7
TUBB3
TuRtEbu2
nclx-12
best_target_protein
PPi_try23
dux4
TNKS2_Random
7Eb4PAnE
ghftee
6erMaIcF
lnc-3
48L1
cyp79a1
0503
Module_5.1
plspls2
vMb7rnvg
uCR55OKu
Hon10
Jekvzxlc
test_FD_18
spflITlk
bXuw1xQg
brf1
c2G8xiRg
QwW3Xn81
SUm2DDqZ
Test331
C05ZJRM5
62738
uhQPv5kI
KsJc5NHF
HIAPP
NC11
prova
C13A4-interactors_ProteinPrompt_Consensus
Qob3SbBD
bn2
jobname
0503-new
ZtbvikJp
624330-624932
poorly
plspls3
CFtH3Roc
k8MndkdH
s_cm
IhAVPdgQ
M9T7tQL6_BLRF2
HSP70-1cons
zip-1
5.1D_Prediction_PPI
ESKYKEILLL
smaller_dapk1
fbeM8W00
FLT14
D.2
CNTN1
FD_Imp
l48-2
PPi_cysK2
Bmf2w4AI
HLA
new_job
HSP90_
aOTymVKH
Sphingomonas_sp.Leaf343
tnfr2
polr3c
TR86Tb0S
kLbWxTxe
KL340
PRMT-
nh3l
8d1gvJgw
FLT17
blae
protocadherin
SLSRWLEAWQ
ZxGTVGIe-bzlf1-rf
C13A4-interactors_ProteinPrompt
TgCRMPet
ESKYKEILL_LTGLDNITDE_ELDRFKFFLS_DEFNIATGKL
7sr0TwDv
JoB3R8Ns
MDA5
KAP3
CFZUmkUI
akt1kinasee
aktrho
virs_ppi
TRPV2_interactome_in_silico
iCPm48xb
PFAEDK
BQxVO2O9
PPi_try17
SET_ME_FREE
2-48
MRC1
P.gir.
C13_G
5.1D_Prediction_PPI2
pl4.1
7X202Usr
module_5
saudhy
NAA10-c
Module-5.1-Part_D
Prova2_PP
HCyoVXNq
FPDU6q1U
thaumatin
HIF1B
FLKL
PPi_try16
MRFwQwnR
mus_mus_mdm2
ex2404171
s_gnn
PRSS8
PPP1CB
Module_51D
7T5lvgmU
HDAC9
A3aoaaWQ
mopygTRZ
FLT13
TNKS1_Graph
Module_5_x
casr_sbank1
294902-295771
PPi_CD
0gE5CSWG
Fzd6
97HVNovC
2nmsn3422
TTwcpoJn
34.5
4rWzhERq
Test#1
sfhdg12
482Q
VBuQy4Tl
PXR-interactors_ProteinPrompt_Graph
qzzz1
PPi_try4
P583
HoWa
ridge
A3VGmt9T
j_jdc
t.parva_nosi
NBSCP2_neural
292761-93414_a
wVA7WIfO
HSP70-1conss
TNKS1-Consensus
TNKS1_C
292761-93414
ADAM21_
ACR1-GS
samhd1
slitrk5-iso2
USxgMpxU
bn
Jag7
ZuR6PDkd
7RORIRWu
polr3f
624945-625745
HSP70-1gnn
APLNREDNRA2
qqq11
nclx-1
KL1
HIMAAMPIATANGGAPINMONAAKO
TMCO6_human
13doEChB
SFIUO3PT
TQIXRb7w-bilf1-gnn
Def3
TgCRAGS
psamhd1
SAP11-1
slitrk5-iso1
G4XCGJMx
FimH_analysis
vvdfhb
hgtyu
ADAM20
Aedes-test
Def
TGM2-
9FRcPmFO
Paltes
APLNREDNRA3
qu9dW1XC
julianhiilikeyousmhuhubakitangcutemo
peptide3
strn3
Def1
48lp
oR8823i5
098
ole
polr3k
ESRRA_R1881
sFlt1-Fc
SP1-1
cWEEhsT8
naa80
rhgCJI0M
PPi_try8
KMASTR
Input_any_preferred_job_name
TG2_-_14-3-3m
HxyvwHw2
CCT2
OgmLPsW2
Sacs
example
5SwS9gXH
XdgAVwUC
NR5A2
crt17
TNKS1_G
TNKS1_interaction_partner
Bnd7N8Ui-bmlf1-gnn
QAR1dnS3
1-602
olepdb
M5D_Test
SAP11
2GiQF9B8_BZLF1
EBV
PPi_try
PPi_try9
iuPMDTZo
can_lup_mdm2
PPi_try15
CSIndTz1
howa10
PRMT
kCZLTs4l
DzfXDvMH
NAA20
TGM2-N
Jag9
C19aaa
43350-44141
phpAD07G
module5.1D
PARP14
6wg1oCsV
12542
ror
1NSBy6li
TBRG4
p86nPV0b
tu0oKy7s
P5
295785-297485
882930-883889
5sKUkHJq
ZBP1-RHIM
NCBZ
JagMCSF
48-LP
SZ6xOsq6
samhd1_variant_1
APLNREDNRA4
PPi_try6
samhd1_variant
rem222
hellocrushwagkanalangumalispls
SP1
7ZtJoPv5
yee
hEoBdrQk-bzlf1-gnn
CJ2
blf_con
Protocad15-Test
APLNR_AB
HMGCS1
884937-885386
8tChvUis
eif3l
crt1
APLNR1
abcdefg
624330;624932
clasp
spike_gnn_try3
fbln5
190_5.1_dee
PEJsFI62
ESRRA_R1881_3
BSA_nanoparticles_interaction
Pemphaxin
cWKVnd0W
Yes
fbln5_k
drVRmkWU
8kSt1C18
NC-LP
UwtAcr6r
vdz4SsFo
76lp
Def2
6wZNMWr2
yz2tgSNe
TNKS1-Graph
dh3l
Module_5
Module_-5.1-Part_D
zAwOohm4
PPi_try12
39K
PPi_try10
Legionella_jordanis
lKOe5vSH
kBtFwDSC
O980eD5Q
kG2z8n55
naip1
FOdZPpyn
0OntZpdM
palld
hepcidin
Kn2G2H2t
abcdefgh
Kir2.1_glycocalyx
ny3UIWuA
ZPBP2.
t5X5pd3s
Yuh
test111
Notch4_protein_interactions
qzzz
FTase
PPi_cysK3
mst1
hipk2
TIOh0vQ7
Module_5.1_Part_D_3
PPi_try3
test1
PPi_try13
ao3l
zv6QObu9
SADAF_MS_THESIS
yeLykbyp
T8B74WXE
5biu51em
moonbina
363020
Zm62QndE
i29LLz5e
7BEBZ69i
Research_Scjolar
QrrlmG4J
sfhdg
2gD2FWB3
ycvUfEXP
klS4eVnZ
NAA10
Porphyromonas_sp.HMSC077F02
ADAM20_
blf
0FsfcSWK-BZLF1
AceRX9ge
dfwanoes2
3ohPFXic
Module_5_xd
DNAJC15
PPi_try7
Module_5.1.D.
Job
TCP1c
9yGu2npy
X9ZUSHwH
FP_1
Jaghgf
QpKm8lBI
yrZznQoU
PRMT5
yXR1T3IV-bglf2-rf
ZUyDFSeE
PPi_try26
FLT18
Peptide_Interaction_Partner_Fishing_Expedition_1
Module5.1
Pp2A
Md1
PRMT2
kif1c
KL305-337
l48
PPi_try21
pcdh15
qqq1
u1rAzDTH
FMS1515
Olp7U9R9
TNKS1Consensus
exmp
t.parva
Module_5.1_Part_D
mqOEBoTy
spike_ppi_3
thaumatin3
spike_gnn_try2
4-_73876-74649
plsplsreverse2
APOL1-G0a
15e7WGkq-bcrf1-gnn
thaumatin2
TSSK1B
ICP34.5
1hhhh0913
t70V7Exv
NBSCP2_consensus
Unknown_Protein
Ta6o5Qwp
qtRH8HQw
LoJLWbfR
vDbTD2Fh
PoorCharPro
vuohLq47
polr3h
dsadsdasda
palladin-h
oSBmc3K1
qqq1111
RSnT2RCL
foxa2
strip1
SNCA_1
AtLig6
1qdCFwGB
FOXL2
foxA2
48-KI
hgfd
190_5.1_dee-1
setdb2
ASER
1M0xIZWX
82CTcgAR
Test#2
MESKYKEILL
bn1
TiQeFhoQ
D0kc3Tcc
Cwo6TwB3
BP7Iqcq9
mUXk6bGF
spike_rf
eexx8W0f
KAILgKR5
lnc
Kylee003
ESRRA_R1881_2
inVxvb5M
isdg
ubq
best_protein
HSP70-1
samhd1_variant_example
KAP31
ZBP1-C
FD_Imp2
cXPKUXJR
TAHI87nT
Zmi3akFm
s---D
ung2qqZs
Qk7JW9qv
HonWan
ZNF143
S0s2EZgM
DL7Rlrem
NCBZ21
CCT2.
c3l
CRMP1
ex2404172
QwkPdLNf
B47O0Pl5
661812-662576
TNKS1
Module_5_PPI
3JW5Zg8Z
2XngWFD3
EHcaUkAt
GV7t76ac
N131-interactors_ProteinPrompt
UR4sWWif
Szg0E5fm
tfoXN
KL340_1
wC0RokUK
TSNAX
PPi_try20
bla
TMCO6_human_wo_exon_11
TG2_-_14-3-3
Module_5.1_Part_D_2
Dsg3
PPi_try5
08uPtFWs-bcfr1-rf
TNKS1-Consensus1
ADAM21
test_FD_R1
Dsg1
5vmwkINQ
kir2.1
4cCL96h6-bilf1-rf
FrlQhaHg
vsKd5pov
BE9iU7MA
akt1kinase
PPi_cysK
test22415552
sdc
TNKS1-Random_Forest
0zgRxE3T
example1
ferr
K391
65257
mJTiCxtZ
Er3RbJZZ
ZPBP2c
casr_sbank5
Module51d
A2_test
HSP90
HART
jyrs
gst
KAP32
UAlx30Q9
FLT15
PPI-Test
Q921I1
XyJg7HdQ
spike_cm
s-DAPK-1
85viFLbb
IN_SILICO
loc
TP2
Kylee001
w0VVtU4F
cW4DbIMc
ggggg
ppiwAHAHA
yes
C19
TMCO6_without_exon_11
BAF47
IWKBEMLh
TGM2h
Kir2.1_H5
Wan10
Kylee002
asdf
helloitsme
vhhgFP4
eK2oKQdT
tthslajflskfgj
test11
JpW46osX
PPi_try22
PPi_try19
mxl-2
PROTEIN_OF_INTEREST
dfwanoes
379270-380094
LGALS7
wV23reOI
akt1.
UBE3A
thaumatin1
SRD5A2
TNKS1_partner
PPi_try2
1-48
qzz
qzzz11
nu4fFasy
k3TvTDi3
Kir2.1_glycocalyx_screen
DMXL2
Mrsv1
Bioinformatician
PRMT+
APLNREDNRA5
ogqcevTm
CJ1
Q921I1_mammilian
Sac
f4EamLTI-bglf2-gnn
PXR-interactors_ProteinPrompt
pl4.12
test_FD
Solanum
HtmMdBwz
ESKYKEILL_LTGLDNITDE
444909-445760
KL2
STADCgXI
ThhwZT4z
2W28wWut
ZNF143_1
N131-interactors_ProteinPrompt_Graph
SHR
482
qVHJZZkP
FAEDKTY
H2_test
Fjdheb
CCT2_
HDOC2b
Wq9toETz
CDK6
CW4sWdw9
Aedes-Test_2
PPi_try25
BD8uuwyW
blf_rf2
blaeukh
FLT16
lqqnfMJi-bmlf1-rf
pppp
lnc-2
FsTTVk25
C19aa
APOL1-G0
a8yd0476
NSP3
HeXhKE9R
TCP12
TCP1
ITPK
NAA30
AdOVKzpf
Serotransferrin
wCzlUb97
Testing
secret
CarP
atf3
polr3d
Md1_1
mIwp1sKZ
Gce6XIcL
C19a
smaller_variant_dapk1
GPNMB
StaR
blf_rf
He0CJ0hb
MXD4_1
NAT9
qqq111
4BTVRAQo
CDK6_C-term_GNN
4ar7pzbo
NCBZ21D
C13_Gr
Protocadherin
QMNtcBUF
APLNR11
samhd1_variant1
74767
TP3805_NWL
qqq
oRAJi5ud
Tubulin
5IEB3mRT
my_protein_job
KC_ARID!A
MSMEG_1428
vmCqlmQk
plspls
JKthFxnt
2gBPWrFS
PPi_try11
Mayw8rwR
ac1
TGM2-N.
TrkB-canonical
peptide1
plsplsreverse
3-48
aqelXWlx
SP1-2
Amylin
3Pk5wVWL
ch3l
QLKFAxn1
NAA25
bXrE1JGM
NCBZ21D1
m2nfs01C
KL3401
TNKS1Forest
nclx
NCBZ2
FIND_A_BINDING_MOTIF
k1yPasKJ
Module_5.1D
teststeste
unk_prot_2
tsKDByVs_BLRF2-RF
ikaaaa
sfhdg1
PIZhnSGN
olMPHXiB
TTR
glKJ3dCB
KNAPAGQETQRGGSKSLLPD
TGM2
PPi_try24
HEmH
Aedes-Test
EBNA1
polr3b
5Ogsaw27
5nGHeLRd
me3l
APOL1_G0
4luLJipw
52Im2SAX
yjb
OGk8iEqZ
0S3EBsTK
477
a6sNR93P
sdc1
BSM-MT
Aedes-Test_1
Example_protein_interactions
Ab1rzNIF
ktktktkt
hP6iOaOn
MXD4
col3a1_full_sequence
N131-interactors_ProteinPrompt_Consensus
unk_prot
ZG5XPEHX
sFlt12
polr3g
neues_FP_Wt
Prova1_PP
CCT2__
snx1
YASVLQQKYGQKKTHDTIIV_KGAYAPKDLSKIRFIDFGAL_ASIESWQSLWSILTGRTQEV_HV
qz1
spike_gnn_try1
CDK6_GNN
4568
1lS4E6Vv
PRSS1288
APLNREDNRA
TCP1.
N25
ex2404173
SKYKEILLLT
TRPV2_interactors
peWR1aJW
Lab_assistant
PPi_try18
kNRuwLk0
Mrsv
polr3a
iUD940B6
ONcsUUWo
PPi_cysK4
Q30aqQ8R
FMS15
LFG_190
naip
generate_random_string
HHng
HH2
HH1
HHcons
First_job
6RyrSJ2z
geyeiESg
LSR2_Leipzig
pvQCiIS3
HIDE1_full
HIDE1_cyto
HIDE1_extra
Module_5.1
73atk28o
Sh0ttunn
vOiA8Cp7
1dPmeHJT
0R2n8hIo
SCARB1_MUTANT_BINDING
col3a1_triplet_comp_1
col3a1_%_comp_5
col3a1_%_comp_2
col3a1_triplet_comp_5
col3a1_triplet_comp_4
col3a1_%_comp_1
col3a1_%_comp_3
col3a1_triplet_comp_3
col3a1_%_comp_4
col3a1_full_sequence
col3a1_triplet_comp_2
GOE_IMP2
GOE_IMP
GOE_Stamp
Model_1-1
Model1-2
Model1-1
SP
fqdJvQnT
Collagen_Type_I_Alpha_I
Collagen_Ia
EduPhD2
lRiJBEos
TfhbwutK
LBg1GbHQ
EduPhD
vsp26-35-nexin3
PRO-IL-1BETA
MAT-IL-1BETA
samhd1_variant_2
samhd1_variant_3
SAMHD1_variant_1
Vangl2
Protein-protein_interactions
ZFi
zebrafishkg
elec
AntibchainC
KrangZF
Krang
KrangZF.
KRANGZF
PPIPrediction
5.1D_Prediction_PPI5
ppiprediction2
5.1D_Prediction_PPI4
5.1D_Prediction_PPI3
Sample1
Sample2
sample
PPIPrediction1
za
proteinprompt_tbk1
B3
B3souris
wTOFPoTi
B3Souris
B3bis
ZNF143_mouse
ZNF143_2
ZNF143
nedd8
MDK_KP
KKKKKKK
iGoWWFS9
iKdwZL59
vIPS1
aqb2bag1
fTvNFkAS
Ug01VEu7
pSEP8RDd
OAtd2xNK
cbCZ62BZ
OcfyNqvW
nAuXT6tZ
WWzNPzIV
bUNPVHyS
FwJUiE2h
7ZTHNkPV
z8dy8yrU
P96Hv5MO
TZWCZx4l
n66t1PLk
test
POLR1D
MMgTTiaZ
MLTLEDKDMKGFSWAIVPALTSLGYLIILVVSIFPFWVRLTNEESHEVFFSGLFENCFNA_KCWKPRPLSIYIILGRVFLLSAVFLAFVTTFIMMPFASEFFPRTWKQNFVLACISFFTGA_CAFLALVLHALEIKALRMKLGPLQFSVLWPYYVLGFGIFLFIVAGTICLIQEMVCPCWHL_LSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI
ZmVDAC1b
Lipin-1_cLip_Domain
ccd
ccdf
NEIL3
protein-protein_interactions_of_CALHM6_2
protein-protein_interactions_of_CALHM6
DUFP
DUFP4R
DUFP2
DUFP4
DUFP3
yzfCPmRH
LWSpGJf7
SSLB23um
qGekVdp3
SRBMr84D
FNVQKGWI
asdfdfsa

Please cite: Sebastian Canzler, Markus Fischer, David Ulbrecht, Nikola Ristic, Peter W Hildebrand, René Staritzbichler: ProteinPrompt: a webserver for predicting protein-protein interactions, bioRxiv 2021.09.03.458859