Completed jobs



Tag
p17_prova
oWZ4bGu6
L1-2_MP
A4_MP
L1_MP_3
L1_MP
G1_MP
ndamayan-SE
cter38aawt
cter25aa_rs
cter38aa_rs1
cter25aa
cter38aa_rs2
cter38aa_rs
r2bnBwgr
interaction_prot_prot
28x5TPeu
9qcdEktn
test1
test
test
M0oCrvKZ
PRMT5.1
Proteins_interacting_with_CagA
ot5yXRSU
WRExmTxh
8c34dTTG
vtCzevuI
AG
knENyw2T
wmlVahwF
m48XmeVl
W3Mb9FuP
TunMVDn7
BRCA1
30
IKzXrrTP
FAM1.1
fUizEDTh
xDyvPK4V
9eiARJqL
BRCA11
FAM1
YRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCY
r73NVUh0
ILefetIk
Uz0TATrw
G2GyymVe
Qx9D8Q94
I857E2R2
u5IVLp9H
1N5wnwaV
GUEtC5cw
00H5ioS4
PRMT5
BW2XVTXP
V76DZ5fH
MTR
9ZxCgg3O
FAM2
78Sc5RLN
Kri
OACaGbwh
ouuryzKL
hehehe
Vf1PR1CO
JGw3pLbL
KadTiLTT
TcsIpAle
QOBZkeLt
nUQnlZ6I
dsadn
uzekNPq4
Ba687uNQ
4vGaCgb7
bW92lPMe
z5AInvms
aeaqJgus
6411uNEV
N2gaDmme
WJPZPI9F
clAWgGDg
LmX8S2eh
0929
ee
tUEWkxMk
RPC1
cvA2Qa0h
MaXRsvOm-Proteins_interacting_with_CagA
imoVaotT
vpoOtrOb
ciH7rWb6
6CfxQmZD
Alpha_TW
hq4R6Trg
WRT1
27
17
18
25
3TVVTtQb
Transferrin
Transferrin_network
ruQTukVu
pdh
>1W85_1|Chains_A,_C,_E,_G|PYRUVATE_DEHYDROGENASE_E1_COMPONENT,_ALPHA_SUBUNIT|GEOBACILLUS_STEAROTHERMOPHILUS_(1422)
GTAAG

Please cite: Sebastian Canzler, Markus Fischer, David Ulbrecht, Nikola Ristic, Peter W Hildebrand, René Staritzbichler: ProteinPrompt: a webserver for predicting protein-protein interactions, bioRxiv 2021.09.03.458859